134147-ML490
SYP (Synaptophysin, Major Synaptic Vesicle Protein p38) (MaxLight 490)
Size
£914.00
- SKU:
- 134147-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-314 from human SYP (AAH64550) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Synaptophysin (p38) is an abundant integral membrane protein of small synaptic vesicles in the brain. It is also present in endocrine cells, where it is associated with small electron-translucent vesicles. Synaptophysin expression has been widely used as a marker for synaptogenesis in developmental studies in vivo and in vitro and as a marker for neuron-specific cell lineages in tumors of the central nervous system and of peripheral neuroendocrine cell derivation. It has multiple transmembrane regions and a cytoplasmic tail that contains 10 copies of a tyrosine-rich repeat. Biochemical experiments have demonstrated that it transverses the membrane four times and has cytoplasmic carboxyl- and amino-termini. It also contain unstable intramolecular disulfide bonds that spontaneously rearrange, thereby creating higher-order polymers that are larger than the native protein and that have distinctly different biochemical properties. Mutations involving the synaptophysin gene may be responsible for an X-linked disorder. Chromosomal localization of the human gene for synaptophysin established the human SYP locus on the X chromosome in subbands Xpll.22-pll.23. It is involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice