SYNE1 (Synaptic Nuclear Envelope Protein 1, Syne-1, Nesprin-1, Enaptin, Myocyte Nuclear Envelope Protein 1, MYNE1, Myne-1, Nuclear Envelope Spectrin Repeat Protein 1, C6orf98, KIAA0796, KIAA1262, KIAA1756)

Size

£685.00

SKU:: 134134
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1561-1671 from SYNE1 (NP_892006) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LRKIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNRDSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTW* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.