134131-PE
Synapsin I (Synapsin 1, Synapsin-1, SYN1, SYN-1, Synapsin-I, SYNI, SYN-I, Brain Protein 4.1) (PE)
Size
£914.00
- SKU:
- 134131-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa362-451 from human SYN1 (NP_008881) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Synapsins are abundant brain proteins essential for regulating neurotransmitter release. All synapsins contain a short N-terminal domain that is highly conserved and phosphorylated by PKA or CaM kinase I. Phosphorylation of synapsin N-terminal domain at Ser9 inhibits its binding to phospholipids and diassociates synapsins from synaptic vesicles. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice