134131-BIOTIN
Synapsin I (Synapsin 1, Synapsin-1, SYN1, SYN-1, Synapsin-I, SYNI, SYN-I, Brain Protein 4.1) (Biotin)
Size
£914.00
- SKU:
- 134131-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa362-451 from human SYN1 (NP_008881) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Synapsins are abundant brain proteins essential for regulating neurotransmitter release. All synapsins contain a short N-terminal domain that is highly conserved and phosphorylated by PKA or CaM kinase I. Phosphorylation of synapsin N-terminal domain at Ser9 inhibits its binding to phospholipids and diassociates synapsins from synaptic vesicles. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice