134091-APC
SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (APC)
Size
£927.00
- SKU:
- 134091-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant corresponding to aa1-96 from human SUMO2 (AAH08450) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2H8
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination. It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1. Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice