134090-FITC
SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (FITC)
Size
£934.00
- SKU:
- 134090-FITC
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SUMO2, aa1-95 (NP_008868.3).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Sentrin-2 also known as SUMO-3 is a novel ubiquitin-like protein that can be conjugated to other proteins in a manner analogous to ubiquitination. It is a 95aa peptide that is 46% identical and 66% homologous to sentrin-1. Sentrin interacts with the death domains of Fas, TNFR1 (tumor necrosis factor receptor 1), PML (a tumor suppressor), Rad51 and Rad 52, which are involved in repairing dsDNA breaks, and with GAP1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice