134086-HRP

SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (HRP)

Size

£914.00

SKU:: 134086-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91 from human SULT2B1 (NP_814444) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: SULT2B1 (Sulfotransferase 2B1; also ST2B1b and alcohol sulfotransferase) is a 45-48kD member of the sulfotransferase 1 family of enzymes. SULT2B1 is widely expressed, being found in platelets, stratum granulosum keratinocytes, breast and prostatic epithelium, and syncytiotrophoblast cells. SULT2B1 catalyzes the sulfonation of DHEA, a precursor for sex steroids, and cholesterol, which supports stratification of the epidermis. Human SULT2B1 is 365aa in length. There are PAPS binding sites between aa70-75 and 147-155, a myristoylation motif between aa255-259, and a Pro-rich region between aa305-364 that may extend enzyme half-life. There is one 43kD splice form (ST2B1a) that shows an eight aa substitution for aa1-23. It is expressed in fetal brain and generates pregnenolone sulfate, a steroid that modulates neurotransmitters. Full-length human SULT2B1b shares only 71% aa identity with mouse SULT2B1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice