134086-BIOTIN

SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (Biotin)

Size

£914.00

SKU:: 134086-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91 from human SULT2B1 (NP_814444) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: SULT2B1 (Sulfotransferase 2B1; also ST2B1b and alcohol sulfotransferase) is a 45-48kD member of the sulfotransferase 1 family of enzymes. SULT2B1 is widely expressed, being found in platelets, stratum granulosum keratinocytes, breast and prostatic epithelium, and syncytiotrophoblast cells. SULT2B1 catalyzes the sulfonation of DHEA, a precursor for sex steroids, and cholesterol, which supports stratification of the epidermis. Human SULT2B1 is 365aa in length. There are PAPS binding sites between aa70-75 and 147-155, a myristoylation motif between aa255-259, and a Pro-rich region between aa305-364 that may extend enzyme half-life. There is one 43kD splice form (ST2B1a) that shows an eight aa substitution for aa1-23. It is expressed in fetal brain and generates pregnenolone sulfate, a steroid that modulates neurotransmitters. Full-length human SULT2B1b shares only 71% aa identity with mouse SULT2B1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice