SULT1B1 (Sulfotransferase Family Cytosolic 1B Member 1, Sulfotransferase 1B1, ST1B1, Sulfotransferase 1B2, ST1B2, SULT1B2, Thyroid Hormone Sulfotransferase)

Size

£698.00

SKU:: 134078
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human SULT1B1 with GST tag.
Clone:: 4C9
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.