SULT1A3 (Sulfotransferase 1A3/1A4, ST1A3/ST1A4, Aryl Sulfotransferase 1A3/1A4, Catecholamine-sulfating Phenol Sulfotransferase, HAST3, M-PST, Monoamine-sulfating Phenol Sulfotransferase, Placental Estrogen Sulfotransferase, Sulfotransferase, Monoamine-preferring, Thermolabile Phenol Sulfotransferase, TL-PST, STM, SULT1A4, MGC117469)

Size

£685.00

SKU:: 134074
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human SULT1A3, aa1-296 (AAH14471).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The human Catecholamine-Sulfating Phenol Sulfotransferase (CSPS) is the only sulfotransferase that catalyses the sulfation of catecholamins, in particular the neurotransmitter dopamine, with high activity. CSPS is required for stimulation by Mn2+ of the sulfating activity and expressed in the human intestine, brain, platelet and other tissues. In the brain it may play a role in regulating the levels of dopamine. It also serves as a detoxifying function in the intestine, where it may detoxify potentially lethal dietary monoamines. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice