SULT1A1 (Sulfotransferase 1A1, ST1A1 ,Aryl Sulfotransferase 1, Phenol Sulfotransferase 1, Phenol-sulfating Phenol Sulfotransferase 1, P-PST 1, Thermostable Phenol Sulfotransferase, Ts-PST, HAST1/HAST2, ST1A3, STP, STP1, OK/SW-cl.88, MGC131921, MGC5163)

Size

£698.00

SKU:: 134073
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-296 from SULT1A1 (AAH00923) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F8
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Cytosolic sulfotransferases catalyze the sulfonation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. They are distinct from Golgi resident sulfotransferases by the absence of transmembrane domains and are located in the cytoplasm. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. The enzyme is more specific for sulfonation on catecholamines, phenolic drugs and neurotransmitters. Because of its ability to modify diverse promutagen and procarcinogen xenobiotics, it is implicated in a range of cancers. The crystal structure of the enzyme reveals that its active site is flexible and can accommodate diverse hydrophobic substrates with varying sizes, shapes and flexibility. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice