134072-ML650
SULT1A1 (Sulfotransferase 1A1, ST1A1 ,Aryl Sulfotransferase 1, Phenol Sulfotransferase 1, Phenol-sulfating Phenol Sulfotransferase 1, P-PST 1, Thermostable Phenol Sulfotransferase, Ts-PST, HAST1/HAST2, ST1A3, STP, STP1, OK/SW-cl.88, MGC131921, MGC5163) (MaxLight 650)
Size
£934.00
- SKU:
- 134072-ML650
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SULT1A1, aa1-295 (AAH00923.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Cytosolic sulfotransferases catalyze the sulfonation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. They are distinct from Golgi resident sulfotransferases by the absence of transmembrane domains and are located in the cytoplasm. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. The enzyme is more specific for sulfonation on catecholamines, phenolic drugs and neurotransmitters. Because of its ability to modify diverse promutagen and procarcinogen xenobiotics, it is implicated in a range of cancers. The crystal structure of the enzyme reveals that its active site is flexible and can accommodate diverse hydrophobic substrates with varying sizes, shapes and flexibility. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice