Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA)

Size

£685.00

SKU:: 134017
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa614-713 from human STRN3 (NP_055389) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SG2NA, also known as Striatin 3, was identified as a human cancer auto-antigen and has not been implicated in vesicular trafficking and signal tranduction. It is highly related to striatin and zinedin (striatin 4). It is a cytoplasmic scaffolding protein that binds to Calmodulin and PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which appears to modulate PP2A activity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.