134017-HRP
Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (HRP)
Size
£914.00
- SKU:
- 134017-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa614-713 from human STRN3 (NP_055389) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- SG2NA, also known as Striatin 3, was identified as a human cancer auto-antigen and has not been implicated in vesicular trafficking and signal tranduction. It is highly related to striatin and zinedin (striatin 4). It is a cytoplasmic scaffolding protein that binds to Calmodulin and PP2A A and C subunits as well as the human homolog of the yeast protein, Mob1, which appears to modulate PP2A activity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice