Stratifin (SFN, SFN Protein, 14-3-3 Protein sigma, 14-3-3 sigma, Epithelial Cell Marker Protein 1, Er, HME1, Mme1, OTTHUMP00000004242, YWHAS) (MaxLight 550)

Size

£934.00

SKU:: 134015-ML550
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human SFN, aa1-248 (NP_006133.1).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Extra Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. 14-3-3 sigma, also known as Stratifin (SFN), belong to the 14-3-3 family. The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, beta, gamma, epsilon, sigma, zeta, tau and eta that have been identified in mammals. 14-3-3 sigma was identified as an epithelial cell marker and appeared to function as a tumor suppressor whose expression can be down regulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice