STON1 (Stonin-1, Stoned B-like Factor, SALF, SBLF, STN1, DKFZp781K2462, MGC149803, MGC149804)

Size

£685.00

SKU:: 134011
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa529-621 from human SBLF (NP_006864) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This protein may be involved in the endocytic machinery. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.