STK4 (Serine/Threonine-protein Kinase 4, STE20-like Kinase MST1, Mammalian STE20-like Protein Kinase 1, MST-1, Serine/Threonine-Protein Kinase Krs-2, MST1, DKFZp686A2068)

Size

£685.00

SKU:: 133996
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-40 from human STK4 (AAH05231) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D7-8A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MST-1 (Mammalian STE20-like kinase 1) is a serine/threonine kinase that has been implicated to play a role in chromatin condensation. Its C-terminal contains nuclear export signals which are released upon caspase mediated cleavage. The N-terminus portion of MST-1 then translocates to the nucleus and will promote chromatin condensation. The full length of MST-1 is localized to the cytoplasm. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.