133996-BIOTIN
STK4 (Serine/Threonine-protein Kinase 4, STE20-like Kinase MST1, Mammalian STE20-like Protein Kinase 1, MST-1, Serine/Threonine-Protein Kinase Krs-2, MST1, DKFZp686A2068) (Biotin)
Size
£914.00
- SKU:
- 133996-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-40 from human STK4 (AAH05231) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D7-8A10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- MST-1 (Mammalian STE20-like kinase 1) is a serine/threonine kinase that has been implicated to play a role in chromatin condensation. Its C-terminal contains nuclear export signals which are released upon caspase mediated cleavage. The N-terminus portion of MST-1 then translocates to the nucleus and will promote chromatin condensation. The full length of MST-1 is localized to the cytoplasm. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice