133995
STK38L (Serine/Threonine-protein Kinase 38-like, NDR2 Protein Kinase, Nuclear Dbf2-related Kinase 2, KIAA0965, NDR2)
Size
£685.00
- SKU:
- 133995
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-465 from STK38L (AAH28603) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- STK38L contains 12 protein kinase catalytic subdomains and a potential bipartite nuclear localization signal. Northern blot analysis revealed expression of a 3.9kb transcript in all tissues tested, with the possible exception of adult brain. Highest expression was in peripheral blood leukocytes. Immunoblot and immunofluorescence microscopy demonstrated predominantly nuclear expression of a 55kD protein. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice