133938-PE
STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (PE)
Size
£914.00
- SKU:
- 133938-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-104 from human STAT5A (AAH27036) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Two highly related, but distinct STAT5 genes (STAT5a and STAT5b) were identified in mice. The aa sequences of Stat5a and Stat5b show approximately 96% sequence similarity, and both proteins are co-expressed in most tissues of both virgin and lactating mice. However, differential accumulation of STAT5a and STAT5b in mRNA has been reported for both muscle and mammary tissue. STAT5 has been shown to be the essential mediator of prolactin induced milk protein gene activation. This antibody detects Stat5 a/b. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice