ST8SIA4 (Sialyltransferase St8Sia IV, ST8SiaIV, ST8SIA-IV, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, Alpha-2,8-sialyltransferase 8D, Polysialyltransferase-1, PST, PST1, Sialyltransferase 8D, SIAT8D, SIAT8-D)

Size

£685.00

SKU:: 133907
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-169 from ST8SIA4 (AAH27866) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.