ST5 (Suppression of Tumorigenicity 5 Protein, DENN Domain-containing Protein 2B, HeLa Tumor Suppression 1, DENND2B, HTS1, MGC33090)

Size

£685.00

SKU:: 133898
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1038-1136 from human ST5 (NP_005409) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ST5 was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.