133897-FITC
ST3GAL4 (NANTA3, SIAT4C, STZ, FLJ11867, FLJ46764, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, Alpha 2,3-sialyltransferase IV, Gal-NAc6S, Gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, SAT-3, ST-4, ST3Gal IV, ST3GalIV, ST3GalA.2, STZ, Sialyltransferase 4C, SIAT4-C, CGS23) (FITC)
Size
£914.00
- SKU:
- 133897-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa31-131 from human ST3GAL4 (NP_006269) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- It may catalyze the formation of the NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc-sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3-galactosyl derivative. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice