133890-PE
ST13 (Hsc70-interacting Protein, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, Suppression of Tumorigenicity 13 Protein, FAM10A1, HIP, SNC6, FLJ27260, MGC129952) (PE)
Size
£914.00
- SKU:
- 133890-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant corresponding to aa1-59 from human ST13 (AAH15317) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- ST13 is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this protein is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice