133826-PE

SRD5A2 (3-oxo-5-alpha-steroid 4-dehydrogenase 2, 5 alpha-SR2, SR Type 2, Steroid 5-alpha-reductase 2, S5AR 2, Type II 5-alpha Reductase, MGC138457) (PE)

Size

£914.00

SKU:: 133826-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa29-128 from human SRD5A2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.