SPDEF (SAM Pointed Domain-containing Ets Transcription Factor, Prostate Epithelium-specific Ets Transcription Factor, Prostate-specific Ets, Prostate-derived Ets Factor, PDEF, PSE)

Size

£685.00

SKU:: 133756
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa92-200 from human SPDEF with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A5
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGD* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.