SOX8 (Transcription Factor SOX-8, MGC24837)

Size

£685.00

SKU:: 133728
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa102-211 from human SOX8 (NP_055402) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5A7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The SOX (SRY-box containing gene) gene family encodes a group of transcription factors defined by the conserved high motility group (HMG) DNA-binding domain. They are involved in the regulation of embryonic development and in the determination of cell fate. SOX8 may play a role in central nervous system, limb and facial development. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.