133636
SNRPA1 (U2 Small Nuclear Ribonucleoprotein A', U2 snRNP A')
Size
£685.00
- SKU:
- 133636
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human SNRPA1, aa1-255 (NP_003081).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- SNRPA1, a 28kD protein, is a specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, common aa motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice