SNCB (Beta-synuclein)

Size

£685.00

SKU:: 133617
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-134 from human SNCB with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Synuclein is a small, soluble protein primarily expressed in neural tissue. The synuclein family includes three known proteins: alpha-synuclein, beta-synuclein, and gamma-synuclein. alpha-Synuclein is a very conserved, small acidic protein (140 residues) with a molecular weight of approximately 19kD that accounts for about 1% of total protein in neurons. It is concentrated primarily in presynaptic axon terminals and plays a central role in initiating Parkinson's disease. It is the principal constituent of Lewy bodies which are formed by protein aggregation and inclusion body formation. alpha-Synuclein lacks secondary or tertiary structure, so it belongs to the family of natively unfolded proteins, many of which act as chaperones. Much of this alpha-synuclein has been post-translationally modified to increase the rate of oligomerization. Mutant forms of alpha-Synuclein are associated with autosomal dominant Parkinson's disease. The mutations increase the aggregation rate of the resultant alpha-synuclein beta-Synuclein is found primarily in brain tissue and is seen mainly in presynaptic terminals. It is predominantly expressed in the neocortex, hippocampus, striatum, thalamus, and cerebellum. beta-Synuclein may protect the central nervous system from the neurotoxic effects of alpha-synuclein by inhibiting aggregation of alpha-synuclein which occurs in neurodegenerative diseases such as Parkinson's disease. gamma-Synuclein is a synuclein protein found primarily in the peripheral nervous system (in primary sensory neurons, sympathetic neurons, and motor neurons) and retina. gamma-Synuclein expression in breast tumors is a marker for tumor progression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice