133617-BIOTIN

SNCB (Beta-synuclein) (Biotin)

Size

£914.00

SKU:: 133617-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-134 from human SNCB with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Extra Details:: Synuclein is a small, soluble protein primarily expressed in neural tissue. The synuclein family includes three known proteins: alpha-synuclein, beta-synuclein, and gamma-synuclein. alpha-Synuclein is a very conserved, small acidic protein (140 residues) with a molecular weight of approximately 19kD that accounts for about 1% of total protein in neurons. It is concentrated primarily in presynaptic axon terminals and plays a central role in initiating Parkinson's disease. It is the principal constituent of Lewy bodies which are formed by protein aggregation and inclusion body formation. alpha-Synuclein lacks secondary or tertiary structure, so it belongs to the family of natively unfolded proteins, many of which act as chaperones. Much of this alpha-synuclein has been post-translationally modified to increase the rate of oligomerization. Mutant forms of alpha-Synuclein are associated with autosomal dominant Parkinson's disease. The mutations increase the aggregation rate of the resultant alpha-synuclein beta-Synuclein is found primarily in brain tissue and is seen mainly in presynaptic terminals. It is predominantly expressed in the neocortex, hippocampus, striatum, thalamus, and cerebellum. beta-Synuclein may protect the central nervous system from the neurotoxic effects of alpha-synuclein by inhibiting aggregation of alpha-synuclein which occurs in neurodegenerative diseases such as Parkinson's disease. gamma-Synuclein is a synuclein protein found primarily in the peripheral nervous system (in primary sensory neurons, sympathetic neurons, and motor neurons) and retina. gamma-Synuclein expression in breast tumors is a marker for tumor progression. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice