SNAP 25 (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa)

Size

£685.00

SKU:: 133603
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa31-130 from human SNA25 with GST tag. MW of the GST tag alone is 26kD.(AAH10647).
Clone:: 4A3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SNAP25 (Synaptosomal associated protein of 25kD) is a presynaptic plasma membrane protein that is widely distributed throughout the brain and involved in the regulation of neurotransmitter release. Decreased levels of SNAP25 have been found in the brains of patients with Down Syndrome and Alzheimer's Disease (Greber et al.,1999). In addition, a significant reduction in the hippocampal expression of SNAP25 has also been found in patients with Schizophrenia (Fatemi et al., 2001). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.