133603-ML490
SNAP 25 (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (MaxLight 490)
Size
£914.00
- SKU:
- 133603-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa31-130 from human SNA25 with GST tag. MW of the GST tag alone is 26kD.(AAH10647).
- Clone:
- 4A3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. SNAP25 (Synaptosomal associated protein of 25kD) is a presynaptic plasma membrane protein that is widely distributed throughout the brain and involved in the regulation of neurotransmitter release. Decreased levels of SNAP25 have been found in the brains of patients with Down Syndrome and Alzheimer's Disease (Greber et al.,1999). In addition, a significant reduction in the hippocampal expression of SNAP25 has also been found in patients with Schizophrenia (Fatemi et al., 2001). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice