SMARCA5 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 5, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin A5, Sucrose Nonfermenting Protein 2 Homolog, hSNF2H, SNF2H, WCRF135)

Size

£685.00

SKU:: 133553
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa59-148 from SMARCA5 (NP_003592) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.