133541-ML490
SMAD5 (Mothers Against Decapentaplegic Homolog 5, Mothers Against DPP Homolog 5, MAD Homolog 5, Mad5, SMAD Family Member 5, SMAD 5, Smad5, JV5-1, MADH5, DKFZp781C1895, DKFZp781O1323) (MaxLight 490)
Size
£914.00
- SKU:
- 133541-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa105-182 from human SMAD5 (AAH09682) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad), have been implicated as downstream effectors of TGFb/BMP signaling. Smad1, Smad5, and Smad8 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF-b and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFb signaling by interfering with TGFb-mediated phosphorylation of other Smad family members. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice