SMAD3 (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, MGC60396)

Size

£760.00

SKU:: 133538
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human SMAD3, aa31-141.
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SMAD3, a transcriptional regulator, is activated by TGF-beta and Activin 1 receptor kinase. SMAD3 recognizes an 8 bp palindromic sequence GTCTAGAC. Upon phosphorylation at two extreme C-terminal serines, SMAD3 is translocated into the nucleus where is forms complexes other SMAD proteins, depending on the activation pathway, and regulates the transcription of target genes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.