SMAD3 (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, MGC60396) (FITC)

Size

£934.00

SKU:: 133538-FITC
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human SMAD3, aa31-141.
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: SMAD3, a transcriptional regulator, is activated by TGF-beta and Activin 1 receptor kinase. SMAD3 recognizes an 8 bp palindromic sequence GTCTAGAC. Upon phosphorylation at two extreme C-terminal serines, SMAD3 is translocated into the nucleus where is forms complexes other SMAD proteins, depending on the activation pathway, and regulates the transcription of target genes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice