SLPI (Secretory Leukocyte Protease Inhibitor, ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4 Four-disulfide Core Domain 4, Antileukoproteinase, Mucus Proteinase Inhibitor, Seminal Proteinase Inhibitor)

Size

£685.00

SKU:: 133526
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa33-133 from human SLPI (NP_003055) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: SLPI is a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.