SLC7A1 (ATRC1, ERR, REC1L, High Affinity Cationic Amino Acid Transporter 1, Ecotropic Retroviral Leukemia Receptor Homolog, Ecotropic Retrovirus Receptor Homolog, Solute Carrier Family 7 Member 1, System Y+ Basic Amino Acid Transporter)

Size

£685.00

SKU:: 133514
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa431-493 from human SLC7A1 (NP_003036) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.