SLC5A2 (SGLT2, Sodium/Glucose Cotransporter 2, Low Affinity Sodium-glucose Cotransporter, Solute Carrier Family 5 Member 2)

Size

£685.00

SKU:: 133503
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein fragment corresponding to amino acids 228-277 of human SLC5A2 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G8
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.