SLC26A3 (Chloride Anion Exchanger, Down-regulated in Adenoma, Protein DRA, Solute Carrier Family 26 Member 3, DRA)

Size

£685.00

SKU:: 133453
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa503-600 from human SLC26A3 (NP_000102) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Chloride/bicarbonate exchanger. Mediates the efficient absorbtion of chloride ions in the colon, participating in fluid homeostasis. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.8ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.