133440-APC

SLC25A24 (Calcium-binding Mitochondrial Carrier Protein SCaMC-1, Mitochondrial ATP-Mg/Pi Carrier Protein 1, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 1, Small Calcium-binding Mitochondrial Carrier Protein 1, Solute Carrier Family 25 Member 24, (APC)1, MCSC1, SCAMC1) (APC)

Size

£927.00

SKU:: 133440-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-67 from human SLC25A24 (NP_037518) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: SLC25A24 (Solute carrier family 25 member 24) is a calcium-dependent mitochondrial solute carrier. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTT* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.