SLC25A16 (Graves Disease Carrier Protein, GDC, Graves Disease Autoantigen, GDA, Mitochondrial Solute Carrier Protein Homolog, Solute Carrier Family 25 Member 16, GDA)

Size

£685.00

SKU:: 133432
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa59-134 from SLC25A16 (NP_689920) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.