SLC22A12 (Solute Carrier Family 22 Member 12, Organic Anion Transporter 4-like Protein, Renal-specific Transporter, RST, Urate Anion Exchanger 1, OATL4, URAT1, UNQ6453/PRO34004)

Size

£685.00

SKU:: 133422
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa281-350 from human SLC22A12 (NP_653186) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.