133416-APC

SLC1A6 (EAAT4, Excitatory Amino Acid Transporter 4, Sodium-dependent Glutamate/Aspartate Transporter, Solute Carrier Family 1 Member 6, MGC33092, MGC43671) (APC)

Size

£927.00

SKU:: 133416-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa500-565 from human SLC1A6 (NP_005062) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D9
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Transports L-glutamate and also L-and D-aspartate. Seems to act as a symport by cotransporting sodium. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGNESAM* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.