SLC15A1 (Solute Carrier Family 15 Member 1, Intestinal H(+)/Peptide Cotransporter, Oligopeptide Transporter, Small Intestine Isoform, Peptide Transporter 1, PEPT1)

Size

£685.00

SKU:: 133406
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa473-573 from human SLC15A1 (NP_005064) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Proton-coupled intake of oligopeptides of 2 to 4aa with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.