133402-HRP
SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter) (HRP)
Size
£914.00
- SKU:
- 133402-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa152-207 from human SLC13A5 (NP_808218) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is 0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects SLC13A5 by immunoperoxidase staining on formalin fixed paraffin embedded human testis. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice