133396-HRP
SLC11A1 (Natural Resistance-associated Macrophage Protein 1, NRAMP 1, LSH, NRAMP, NRAMP1) (HRP)
Size
£914.00
- SKU:
- 133396-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa308-350 from human SLC11A1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- NRAMP1, also known as SLC11A1, is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as leprosy and tuberculosis, and inflammatory diseases such as Crohn disease and rheumatoid arthritis. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice