133385-BIOTIN

SLA (Src-like-adapter, Src-like-adapter Protein 1, SLAP, hSLAP, SLA1, SLAP1, SLAP-1) (Biotin)

Size

£914.00

SKU:: 133385-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-277 from human SLA (AAH07042) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: SLAP also known as Src-like-adapter protein 1 is a 276aa containing adapter protein, functioning as a negative regulator of T-cell receptor (TCR) signaling. SLAP belonging to the SRC family of cytoplasmic tyrosine kinases contains a SH2 domain and a SH3 domain. This cytoplasmic protein colocalizes with endosomes and is known to inhibit T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. It acts as a negative regulator of positive selection and mitosis of T-cells. SLAP may act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins. Expression of SLAP is weak in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas but is high in lung and fetal brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice