133380-HRP
SKP1 (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1, EMC19, OCP2, SKP1A, TCEB1L, MGC34403) (HRP)
Size
£934.00
- SKU:
- 133380-HRP
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SKP1, aa1-160 (NP_008861.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- S-phase kinase-associated protein 1A (Skp1) is a component of the SCF ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. Skp1 interacts directly with cullin 1 and F-box proteins in the SCF complex. It is also involved in the control of beta-catenin levels and the activity of beta-catenin dependent TCF transcription factors. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice