133341-ML490
Siglec 10 (Sialic Acid-binding Ig-like Lectin 10, Siglec like Protein 2, SLG2, UNQ477, PRO940) (MaxLight 490)
Size
£914.00
- SKU:
- 133341-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa589-697 from human SIGLEC10 (NP_149121) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Siglecs (sialic acid binding Ig-like lectins) are Itype lectins that belong to the immunoglobulin superfamily. They are characterized by a V-type-Iglike domain which mediates sialic acid binding, followed by varying numbers of C2-type Iglike domains. Mouse Siglec-G, the apparent ortholog of human Siglec-10, is a 110-120kD, 688 amino acid (aa) type I transmembrane protein mainly expressed on mouse B1-type B cells. It controls B1 cell survival, selection, expansion and calcium signaling by negatively regulating B cell receptor signals. A potentially secreted 269aa variant diverges after the first two Ig-like domains. Mouse Siglec-G shares ~63% aa sequence identity with human Siglec-10 within the extracellular domain. pplications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice